Bacterial taxon 233412
Protein WP_041603322.1
DNA starvation/stationary phase protection protein
Haemophilus ducreyi 35000HP
Gene ftpA, UniProt Q47953
>WP_041603322.1|Haemophilus ducreyi 35000HP|DNA starvation/stationary phase protection protein
MRSKTITFPVLKLTGQSQALTNDMHKNADHTVPGLTVATGHLIAEALQMRLQGLNELALILKHAHWNVVGPQFIAVHEMLDSQVDEVRDFIDEIAERMATLGVAPNGLSGNLVETRQSPEYPLGRATAQDHLKLIDLYYSHNIEAHRVVLEHNGHLDPISEDLLVAQTRSLEKLQWFIRAHLDNGNGNI
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ -0.98 | -0.980524403135146 | 0.00055 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 61.6 ms
(Link to these results)