Host taxon 9606
Protein NP_002629.1
elafin preproprotein
Homo sapiens
Gene PI3, UniProt P19957
>NP_002629.1|Haemophilus ducreyi 35000HP|elafin preproprotein
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 8.5 | 8.49811012624115 | 5.1e-30 | 31213562 | |
Retrieved 1 of 1 entries in 29.5 ms
(Link to these results)