Host taxon 9606
Protein NP_001129076.1
endothelial cell-specific molecule 1 isoform b precursor
Homo sapiens
Gene ESM1, UniProt Q9NQ30
>NP_001129076.1|Haemophilus ducreyi 35000HP|endothelial cell-specific molecule 1 isoform b precursor
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.04 | 3.04052821577301 | 3.4e-5 | 31213562 | |
Retrieved 1 of 1 entries in 33.7 ms
(Link to these results)