Bacterial taxon 233412
Protein WP_010944082.1
F0F1 ATP synthase subunit A
Haemophilus ducreyi 35000HP
Gene atpB, UniProt Q7VPP6
>WP_010944082.1|Haemophilus ducreyi 35000HP|F0F1 ATP synthase subunit A
MAVNTAEYIGHHLSFLSSGDGFWAVHLDTLFFSLVAGVLFLVVFSRVAKNATTGVPGKLQCLVEMVVEWVDGLVKDNFHGPRHMIAPLALTIFCWVFIMNAIDLVPVDFLPQLANMFGIHYLRAVPTADISATLGMSICVFGLILFYTVKSKGFNGLAKEYTLHPFNHWAFIPVNFILETVTLLAKPISLAFRLFGNMYAGELIFILIAVMYMADNFALQALGIPLHLVWAIFHILVITLQAFIFMMLTIVYLSIAYNKADH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ 1.38 | 1.37872340022943 | 4.0e-15 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 3.1 ms
(Link to these results)