Bacterial taxon 233412
Protein WP_010944085.1
F0F1 ATP synthase subunit delta
Haemophilus ducreyi 35000HP
Gene atpH, UniProt Q7VPP3
>WP_010944085.1|Haemophilus ducreyi 35000HP|F0F1 ATP synthase subunit delta
MSELSTVARPYAKAAFDFALEQGQLDKWQEMLQFSALVAENEQVVEYITSSLASGQISEIFLQICDDQLDQYGQNFIRVMAENKRLAILPEVFNRFNALRAEYEAIKKVIVVSATELSQAQEEKIAKAMEKRLGQKVRLTTEIDSTLLTGIIIKYDDIVIDGSSRGQLNRLTQALSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ 0.79 | 0.787850232542085 | 0.0012 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 2.7 ms
(Link to these results)