Bacterial taxon 233412
Protein WP_010944139.1
ferredoxin-type protein NapG
Haemophilus ducreyi 35000HP
Gene napG, UniProt Q7VPJ6
>WP_010944139.1|Haemophilus ducreyi 35000HP|ferredoxin-type protein NapG
MKLDSNRRQFLKNATRTAAGMCGIGIILGLQQQQSFAREGVALRPPGALPEKNFLACTRCGQCVQACPYDTLRLASLLSPMEAGTPYFVARAKPCEMCVDIPCMNACPSGALTEALQDINDARMGLAVLLDHETCLNWQGLRCDVCYRVCPLIDKAITLEEIRNERTRIHAKFIPTVHSNACTGCGKCEQACVLEEVAIKVLPTDLAKGLLGRHYRLGWQEKQNAGKSLIEAQHPEGFTTMEIRTPTGVSEQSYQHMKVRPNQKVVTPSRATQDYVPSSTTVEAPQHFPDLELNLKGVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ 1.04 | 1.03820790573851 | 0.0002 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 26 ms
(Link to these results)