Bacterial taxon 233412
Protein WP_010945181.1
Flp family type IVb pilin
Haemophilus ducreyi 35000HP
Gene flp2, UniProt G1UBB1
>WP_010945181.1|Haemophilus ducreyi 35000HP|Flp family type IVb pilin
MLSVLMTQAYISATESLRTSIQRFRKNQQGVTAIEYGLIAVAVAILIIAVFYNNQGFLMKLKTKFSDLATGISAQSVSFNN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●●●○ 3.27 | 3.2713057479566 | 1.6e-12 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 38.1 ms
(Link to these results)