Host taxon 9606
Protein NP_001263430.1
G-protein-signaling modulator 3
Homo sapiens
Gene GPSM3, UniProt Q9Y4H4
>NP_001263430.1|Haemophilus ducreyi 35000HP|G-protein-signaling modulator 3
MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.94 | 3.93841038082396 | 0.037 | 31213562 | |
Retrieved 1 of 1 entries in 39.2 ms
(Link to these results)