Host taxon 9606
Protein NP_001819.2
galectin-10
Homo sapiens
Gene CLC, UniProt Q05315
>NP_001819.2|Haemophilus ducreyi 35000HP|galectin-10
MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.13 | 4.1313949454527 | 0.0096 | 31213562 | |
Retrieved 1 of 1 entries in 67.1 ms
(Link to these results)