Host taxon 9606
Protein NP_006323.2
gamma-interferon-inducible lysosomal thiol reductase preproprotein
Homo sapiens
Gene IFI30, UniProt P13284
>NP_006323.2|Haemophilus ducreyi 35000HP|gamma-interferon-inducible lysosomal thiol reductase preproprotein
MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.14 | 4.14202757902961 | 7.5e-14 | 31213562 | |
Retrieved 1 of 2 entries in 24.1 ms
(Link to these results)