Host taxon 9606
Protein NP_001287937.1
glia maturation factor gamma isoform 2
Homo sapiens
Gene GMFG, UniProt O60234
>NP_001287937.1|Haemophilus ducreyi 35000HP|glia maturation factor gamma isoform 2
MVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.66 | 3.66412094850495 | 1.5e-16 | 31213562 | |
Retrieved 1 of 2 entries in 20.6 ms
(Link to these results)