Host taxon 9606
Protein NP_001136248.2
glutathione-specific gamma-glutamylcyclotransferase 1 isoform b
Homo sapiens
Gene CHAC1, UniProt Q9BUX1
>NP_001136248.2|Haemophilus ducreyi 35000HP|glutathione-specific gamma-glutamylcyclotransferase 1 isoform b
MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.81 | 2.81011498240624 | 0.00079 | 31213562 | |
Retrieved 1 of 1 entries in 58.8 ms
(Link to these results)