Host taxon 9606
Protein NP_000750.1
granulocyte colony-stimulating factor isoform a precursor
Homo sapiens
Gene CSF3, UniProt P09919
>NP_000750.1|Haemophilus ducreyi 35000HP|granulocyte colony-stimulating factor isoform a precursor
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 7.17 | 7.16650881838302 | 9.9e-9 | 31213562 | |
Retrieved 1 of 3 entries in 60.6 ms
(Link to these results)