Host taxon 9606
Protein NP_001257710.1
granzyme H isoform 3 precursor
Homo sapiens
Gene GZMH, UniProt P20718
>NP_001257710.1|Haemophilus ducreyi 35000HP|granzyme H isoform 3 precursor
MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.7 | 3.69962771496923 | 1.4e-5 | 31213562 | |
Retrieved 1 of 1 entries in 7.3 ms
(Link to these results)