Host taxon 9606
Protein NP_056490.2
growth arrest and DNA damage-inducible protein GADD45 beta
Homo sapiens
Gene GADD45B, UniProt O75293
>NP_056490.2|Haemophilus ducreyi 35000HP|growth arrest and DNA damage-inducible protein GADD45 beta
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.09 | 3.08642720680181 | 1.1e-9 | 31213562 | |
Retrieved 1 of 2 entries in 38.6 ms
(Link to these results)