Host taxon 9606
Protein NP_001007470.1
hematopoietic cell signal transducer isoform 2 precursor
Homo sapiens
Gene HCST, UniProt Q9UBK5
>NP_001007470.1|Haemophilus ducreyi 35000HP|hematopoietic cell signal transducer isoform 2 precursor
MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQDGKVYINMPGRG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.37 | 3.36704892102211 | 9.0e-14 | 31213562 | |
Retrieved 1 of 1 entries in 7.1 ms
(Link to these results)