Host taxon 9606
Protein NP_066998.1
hepcidin preproprotein
Homo sapiens
Gene HAMP, UniProt P81172
>NP_066998.1|Haemophilus ducreyi 35000HP|hepcidin preproprotein
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.56 | 3.56275880988672 | 3.9e-5 | 31213562 | |
Retrieved 1 of 1 entries in 36.2 ms
(Link to these results)