Host taxon 9606
Protein NP_004097.1
high affinity immunoglobulin epsilon receptor subunit gamma precursor
Homo sapiens
Gene FCER1G, UniProt P30273
>NP_004097.1|Haemophilus ducreyi 35000HP|high affinity immunoglobulin epsilon receptor subunit gamma precursor
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.55 | 4.55475616188231 | 3.3e-18 | 31213562 | |
Retrieved 1 of 1 entries in 51.8 ms
(Link to these results)