Host taxon 9606
Protein NP_001020329.1
HLA class II histocompatibility antigen gamma chain isoform c
Homo sapiens
Gene CD74, UniProt P04233
>NP_001020329.1|Haemophilus ducreyi 35000HP|HLA class II histocompatibility antigen gamma chain isoform c
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.04 | 3.04424388974457 | 2.0e-11 | 31213562 | |
Retrieved 1 of 1 entries in 51.6 ms
(Link to these results)