Bacterial taxon 233412
Protein WP_010944980.1
hypothetical protein
Haemophilus ducreyi 35000HP
Gene n/a, UniProt Q7VMC6
>WP_010944980.1|Haemophilus ducreyi 35000HP|hypothetical protein
MKLNKLVVGLSLFITACNSNPAKQAEQQTKKIKQQQALSIELARQCDHETAELMQQIYNSNVGMTEAEKRTLNQRYQQKISDPLFESCNKLAWENHKHQMELQEIRRRYDMEYPTFFSKPFGYHCW
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●●○○ -2.7 | -2.69513025223029 | 6.7e-12 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)