Host taxon 9606
Protein NP_001332933.1
IGF-like family receptor 1 isoform c precursor
Homo sapiens
Gene IGFLR1, UniProt Q9H665
>NP_001332933.1|Haemophilus ducreyi 35000HP|IGF-like family receptor 1 isoform c precursor
MGPGRCLLTALLLLALAPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPELSSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAYSLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.94 | 2.93889684821037 | 2.6e-10 | 31213562 | |
Retrieved 1 of 2 entries in 2.9 ms
(Link to these results)