Host taxon 9606
Protein NP_036224.1
inducible T-cell costimulator precursor
Homo sapiens
Gene ICOS, UniProt Q9Y6W8
>NP_036224.1|Haemophilus ducreyi 35000HP|inducible T-cell costimulator precursor
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.36 | 4.35614147208693 | 1.7e-11 | 31213562 | |
Retrieved 1 of 2 entries in 60.7 ms
(Link to these results)