Host taxon 9606
Protein NP_001123552.1
interferon alpha-inducible protein 27, mitochondrial isoform 1
Homo sapiens
Gene IFI27, UniProt P40305
>NP_001123552.1|Haemophilus ducreyi 35000HP|interferon alpha-inducible protein 27, mitochondrial isoform 1
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.11 | 4.1079334655277 | 3.0e-8 | 31213562 | |
Retrieved 1 of 1 entries in 46.3 ms
(Link to these results)