Host taxon 9606
Protein NP_006426.2
interferon-induced transmembrane protein 2
Homo sapiens
Gene IFITM2, UniProt Q01629
>NP_006426.2|Haemophilus ducreyi 35000HP|interferon-induced transmembrane protein 2
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.46 | 3.46497635987249 | 1.7e-19 | 31213562 | |
Retrieved 1 of 1 entries in 58 ms
(Link to these results)