Host taxon 9606
Protein NP_066362.2
interferon-induced transmembrane protein 3
Homo sapiens
Gene IFITM3, UniProt Q01628
>NP_066362.2|Haemophilus ducreyi 35000HP|interferon-induced transmembrane protein 3
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.19 | 3.18806654622708 | 9.0e-25 | 31213562 | |
Retrieved 1 of 1 entries in 2.8 ms
(Link to these results)