Host taxon 9606
Protein NP_000568.1
interleukin-1 receptor antagonist protein isoform 3
Homo sapiens
Gene IL1RN, UniProt P18510
>NP_000568.1|Haemophilus ducreyi 35000HP|interleukin-1 receptor antagonist protein isoform 3
MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.08 | 4.08352371864711 | 3.4e-11 | 31213562 | |
Retrieved 1 of 2 entries in 22.2 ms
(Link to these results)