Host taxon 9606
Protein NP_000563.1
interleukin-10 precursor
Homo sapiens
Gene IL10, UniProt P22301
>NP_000563.1|Haemophilus ducreyi 35000HP|interleukin-10 precursor
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.12 | 3.1201936892285 | 1.8e-5 | 31213562 | |
Retrieved 1 of 2 entries in 9.2 ms
(Link to these results)