Host taxon 9606
Protein NP_000632.1
interleukin-11 isoform 1 precursor
Homo sapiens
Gene IL11, UniProt P20809
>NP_000632.1|Haemophilus ducreyi 35000HP|interleukin-11 isoform 1 precursor
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.25 | 4.2519829043382 | 1.7e-6 | 31213562 | |
Retrieved 1 of 2 entries in 15.9 ms
(Link to these results)