Host taxon 9606
Protein NP_443104.1
interleukin-17F precursor
Homo sapiens
Gene IL17F, UniProt Q96PD4
>NP_443104.1|Haemophilus ducreyi 35000HP|interleukin-17F precursor
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.23 | 4.22587582840755 | 0.035 | 31213562 | |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)