Host taxon 9606
Protein NP_057668.1
interleukin-23 subunit alpha precursor
Homo sapiens
Gene IL23A, UniProt Q9NPF7
>NP_057668.1|Haemophilus ducreyi 35000HP|interleukin-23 subunit alpha precursor
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.05 | 3.05187223822962 | 1.4e-6 | 31213562 | |
Retrieved 1 of 1 entries in 32.1 ms
(Link to these results)