Host taxon 9606
Protein NP_001012649.1
interleukin-32 isoform B
Homo sapiens
Gene IL32, UniProt P24001
>NP_001012649.1|Haemophilus ducreyi 35000HP|interleukin-32 isoform B
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.42 | 3.42257383875844 | 5.3e-12 | 31213562 | |
Retrieved 1 of 1 entries in 2.8 ms
(Link to these results)