Host taxon 9606
Protein NP_001265497.1
interleukin-36 gamma isoform 2
Homo sapiens
Gene IL36G, UniProt Q9NZH8
>NP_001265497.1|Haemophilus ducreyi 35000HP|interleukin-36 gamma isoform 2
MRGTPGDADGGGRAVYQSITVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.08 | 4.08046287024517 | 1.8e-11 | 31213562 | |
Retrieved 1 of 1 entries in 95.6 ms
(Link to these results)