Bacterial taxon 233412
Protein WP_010945003.1
ISC system 2Fe-2S type ferredoxin
Haemophilus ducreyi 35000HP
Gene fdx2, UniProt Q7VMA3
>WP_010945003.1|Haemophilus ducreyi 35000HP|ISC system 2Fe-2S type ferredoxin
MPKVVFLPHEEFCPEGMVIEAKSGDNLLELAHNAGVEIHHACDASCACTTCHVVIREGFDSLNETSDQEEDMLDKAWGLEMDSRLSCQCIVGEEDLVVEIPKYNLNHANEAAH
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ -1.58 | -1.57924770119438 | 1.1e-5 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 95.5 ms
(Link to these results)