Host taxon 9606
Protein NP_001335107.1
kallikrein-13 isoform 3 precursor
Homo sapiens
Gene KLK13, UniProt Q9UKR3
>NP_001335107.1|Haemophilus ducreyi 35000HP|kallikrein-13 isoform 3 precursor
MWPLALVIASLTLALSGVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.25 | 3.24750772797157 | 3.8e-15 | 31213562 | |
Retrieved 1 of 3 entries in 15.8 ms
(Link to these results)