Host taxon 9606
Protein NP_001017978.1
kita-kyushu lung cancer antigen 1
Homo sapiens
Gene CT83, UniProt Q5H943
>NP_001017978.1|Haemophilus ducreyi 35000HP|kita-kyushu lung cancer antigen 1
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.62 | 4.61939840735067 | 4.3e-5 | 31213562 | |
Retrieved 1 of 1 entries in 7.4 ms
(Link to these results)