Host taxon 9606
Protein NP_848522.1
late cornified envelope protein 3E
Homo sapiens
Gene LCE3E, UniProt Q5T5B0
>NP_848522.1|Haemophilus ducreyi 35000HP|late cornified envelope protein 3E
MSCQQNQKQCQPPPKCPSPKCPPKNPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRSNSCDRGSGQQGGGSGCCHGSGGCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.24 | 4.23818922724883 | 7.2e-9 | 31213562 | |
Retrieved 1 of 1 entries in 3.5 ms
(Link to these results)