Host taxon 9606
Protein NP_001010857.1
late cornified envelope-like proline-rich protein 1
Homo sapiens
Gene LELP1, UniProt Q5T871
>NP_001010857.1|Haemophilus ducreyi 35000HP|late cornified envelope-like proline-rich protein 1
MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.89 | -3.89237636054419 | 1.0e-7 | 31213562 | |
Retrieved 1 of 1 entries in 59.2 ms
(Link to these results)