Host taxon 9606
Protein NP_001070895.1
ly6/PLAUR domain-containing protein 1 isoform b
Homo sapiens
Gene LYPD1, UniProt Q8N2G4
>NP_001070895.1|Haemophilus ducreyi 35000HP|ly6/PLAUR domain-containing protein 1 isoform b
MCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAHC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.39 | 3.39211241575601 | 3.8e-6 | 31213562 | |
Retrieved 1 of 1 entries in 10.8 ms
(Link to these results)