Host taxon 9606
Protein NP_057543.2
marginal zone B- and B1-cell-specific protein precursor
Homo sapiens
Gene MZB1, UniProt Q8WU39
>NP_057543.2|Haemophilus ducreyi 35000HP|marginal zone B- and B1-cell-specific protein precursor
MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.59 | 3.58915296491795 | 2.5e-13 | 31213562 | |
Retrieved 1 of 1 entries in 100 ms
(Link to these results)