Host taxon 9606
Protein NP_783316.2
metallothionein-1E isoform 2
Homo sapiens
Gene MT1E, UniProt P04732
>NP_783316.2|Haemophilus ducreyi 35000HP|metallothionein-1E isoform 2
MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.03 | 3.02517485774584 | 5.0e-15 | 31213562 | |
Retrieved 1 of 1 entries in 40.1 ms
(Link to these results)