Host taxon 9606
Protein NP_001078957.1
modulator of macroautophagy TMEM150B isoform a
Homo sapiens
Gene TMEM150B, UniProt A6NC51
>NP_001078957.1|Haemophilus ducreyi 35000HP|modulator of macroautophagy TMEM150B isoform a
MWGYLSLMPVFLAVWAISGVWIVFAIAVTNRTVDLSKGFPYISICGSFPPQSCIFSQVLNMGAALAAWICIVRYHQLRDWGVRRWPNQLILWTGLLCALGTSVVGNFQEKNQRPTHLAGAFLAFILGNVYFWLQLLLWRLKRLPQPGAAWIGPLRLGLCSVCTILIVAMIVLHACSLRSVSAACEWVVAMLLFALFGLLAVDFSALESCTLCVQPWPSLSPPPASPISLPVQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.81 | 3.81170718507523 | 1.3e-9 | 31213562 | |
Retrieved 1 of 1 entries in 18.9 ms
(Link to these results)