Host taxon 9606
Protein NP_057064.1
neuronal vesicle trafficking-associated protein 2
Homo sapiens
Gene NSG2, UniProt Q9Y328
>NP_057064.1|Haemophilus ducreyi 35000HP|neuronal vesicle trafficking-associated protein 2
MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.57 | 4.57399488414793 | 0.0035 | 31213562 | |
Retrieved 1 of 1 entries in 38.4 ms
(Link to these results)