Bacterial taxon 233412
Protein WP_010945106.1
outer membrane protein assembly factor BamE
Haemophilus ducreyi 35000HP
Gene smpA, UniProt Q7VM11
>WP_010945106.1|Haemophilus ducreyi 35000HP|outer membrane protein assembly factor BamE
MKIKSLLAIALLAVGVTGCSTIKKVVYRIDVPQGNYLEQDKIDQVKIGMNKTQVQYLLGTPMLKDIFHLERWNYVFIKREGYNDPVQHTLFIYFDKNGLVKDIQLDKPILEAESQQEMPKETENMPN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●●○○ -2.58 | -2.57856785968183 | 8.8e-13 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)