Bacterial taxon 233412
Protein WP_010944468.1
pantetheine-phosphate adenylyltransferase
Haemophilus ducreyi 35000HP
Gene coaD, UniProt Q7VNN7
>WP_010944468.1|Haemophilus ducreyi 35000HP|pantetheine-phosphate adenylyltransferase
MSYTVIYAGTFDPITNGHLDIITRATKLFAKVIVAVAQNPTKQPLFSLSERTALVAQSCSHLTNVEAVSFSGLLADFARQHHAKALIRGIRGSDDIEYEIQLSQLNNKLADGLETVFLPPAVEWRYLSSTMIREIYYHQGQVNAFVPTAVVQALQNRKNNE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●○○○○ 0.7 | 0.702020036618869 | 0.011 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 21.5 ms
(Link to these results)