Bacterial taxon 233412
Protein WP_010945161.1
peptide-methionine (R)-S-oxide reductase MsrB
Haemophilus ducreyi 35000HP
Gene msrB, UniProt Q7VLV8
>WP_010945161.1|Haemophilus ducreyi 35000HP|peptide-methionine (R)-S-oxide reductase MsrB
MKAISDLTKEQREILINHGTELPFTGKFLNEARTGTYRCVRCHHSLFRSDTKFDAGCGWPSFYEAISAEALRYVDDYRLSRPRTEIRCAHCDSHLGHVFNDGPPPTGLRFCLNSVALNFKWDQTGEEIDG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | pathogen | Skin tissue | 6-8 days | ●●○○○ 1.05 | 1.05439305684205 | 0.00016 | 31213562 | Bacterial control measured at mid-exponential growth phase |
Retrieved 1 of 1 entries in 50.8 ms
(Link to these results)