Host taxon 9606
Protein NP_004576.2
phospholipase A and acyltransferase 4
Homo sapiens
Gene PLAAT4, UniProt Q9UL19
>NP_004576.2|Haemophilus ducreyi 35000HP|phospholipase A and acyltransferase 4
MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.93 | 3.93218104530131 | 6.6e-10 | 31213562 | |
Retrieved 1 of 1 entries in 107.8 ms
(Link to these results)