Host taxon 9606
Protein NP_000291.1
phospholipase A2, membrane associated precursor
Homo sapiens
Gene PLA2G2A, UniProt P14555
>NP_000291.1|Haemophilus ducreyi 35000HP|phospholipase A2, membrane associated precursor
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.72 | 3.71884195803609 | 6.6e-6 | 31213562 | |
Retrieved 1 of 2 entries in 28.3 ms
(Link to these results)