Host taxon 9606
Protein NP_001124187.1
placenta-specific gene 8 protein
Homo sapiens
Gene PLAC8, UniProt Q9NZF1
>NP_001124187.1|Haemophilus ducreyi 35000HP|placenta-specific gene 8 protein
MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.33 | 4.33069331425159 | 2.6e-10 | 31213562 | |
Retrieved 1 of 1 entries in 31.4 ms
(Link to these results)