Host taxon 9606
Protein NP_001291651.1
pleckstrin homology domain-containing family O member 1 isoform b
Homo sapiens
Gene PLEKHO1, UniProt Q53GL0
>NP_001291651.1|Haemophilus ducreyi 35000HP|pleckstrin homology domain-containing family O member 1 isoform b
MAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.87 | 2.8679106181839 | 4.3e-16 | 31213562 | |
Retrieved 1 of 2 entries in 44.4 ms
(Link to these results)