Host taxon 9606
Protein NP_001006625.1
podoplanin isoform c
Homo sapiens
Gene PDPN, UniProt Q86YL7
>NP_001006625.1|Haemophilus ducreyi 35000HP|podoplanin isoform c
MPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.51 | 3.51310071534735 | 2.1e-16 | 31213562 | |
Retrieved 1 of 1 entries in 3.7 ms
(Link to these results)